PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00142.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 884aa    MW: 98869.1 Da    PI: 4.5439
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00142.1_g00013.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.8e-51251521128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yL++k+ gk +++ e+++e+d+yk+ePw+L+  +++k+++ ewyfFs+ d+ky +g+r nrat +gyWk
  Sme2.5_00142.1_g00013.1  25 LAPGFRFHPTDEELVRYYLRRKACGKLFRF-EAVAEIDVYKSEPWELKvySALKTRDLEWYFFSPVDRKYGNGSRLNRATGQGYWK 109
                              579************************999.89**************95336777888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v + + +++g+kktLvf++grap+g++t+Wvmheyrl
  Sme2.5_00142.1_g00013.1 110 ATGKDRPVRH-NAKTIGMKKTLVFHNGRAPDGQRTNWVMHEYRL 152
                              **********.999****************************98 PP

2NAM106.14.5e-3337547833128
                      NAM  33 v.ikevdiykvePwdLpk.......kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfyk 110
                              +  +++d+++ e +dL++       ++k+++ ewyfFs  dkky +g r+nrat++gyWk+tgkd++v+++k+e+vg+kktLv++ 
  Sme2.5_00142.1_g00013.1 375 IlQSRIDLLNKENEDLRRlvrggmsRLKTRDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVHRNKSEVVGMKKTLVYHI 460
                              31456699999999998557787777777888****************************************************** PP

                      NAM 111 grapkgektdWvmheyrl 128
                              grapkg++t+Wvmheyrl
  Sme2.5_00142.1_g00013.1 461 GRAPKGQRTNWVMHEYRL 478
                              ****************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5919175IPR003441NAC domain
PROSITE profilePS5100557.42425175IPR003441NAC domain
PfamPF023651.7E-2727152IPR003441NAC domain
PROSITE profilePS5100536.791337501IPR003441NAC domain
PfamPF023652.2E-15396478IPR003441NAC domain
SuperFamilySSF1019414.05E-38399501IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 884 aa     Download sequence    Send to blast
MEQEGVLVLK PAPARAVAAA PPTSLAPGFR FHPTDEELVR YYLRRKACGK LFRFEAVAEI  60
DVYKSEPWEL KVYSALKTRD LEWYFFSPVD RKYGNGSRLN RATGQGYWKA TGKDRPVRHN  120
AKTIGMKKTL VFHNGRAPDG QRTNWVMHEY RLADEELELA GVVQDAFVLC RIFQKSGLGP  180
PNGDRYAPFI EEEWDDDDTT HLVPGGAAEV DVAIGDEARI EGNDLDQDAR GKAPCQSENL  240
LEARALSFVC KRERSEEELE PLSLAQSKRS KHDDPSSSHA NGSEDSTTSQ QDPPTTMMTT  300
NYSPPLLTFP LLESLEPKEA QPSNSLNFDS SNLEKSVPPG YLKFISNLEN EILNVSMERE  360
TAKIEVMRAQ AMINILQSRI DLLNKENEDL RRLVRGGMSR LKTRDLEWYF FSVLDKKYGN  420
GARTNRATEK GYWKTTGKDR AVHRNKSEVV GMKKTLVYHI GRAPKGQRTN WVMHEYRLID  480
EALDRAGIPQ DAFVLCRVFQ KSGAGPKNGE QYGAPFIEEE WEDDDVQVLP KDEAAEEFVF  540
GDDIHLDANE LDQILGTGTA VAGAAHPSDY SWDENGSTEE TNNSSDAQNW VKQPGELKPI  600
DLAVQQKFDA PDQVNHEYIG ESSKNMNSED GDYLLNEPIV NGTDDLQFSD EAFLEANDLS  660
NPVEVDRSGF DMLEEYLTYF DANDDFQNMS FDPSVFFGND DQISDQALPP EKDIGEATQQ  720
FIAPSEGLGE DTNDLAASSK LVPTKPGSDC QYLFMKKASQ MLGNIHAPPA FASEFPTKEA  780
TLRLNLPSQS VSSVQFTADL VQIRDMSAAG NEMGWPLGKH SDYNIILSFG LSRGGSDDSG  840
MESFHSIHPG KTASAIFRGW FYYLFFSFLM LLMSIRIGTM ISAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-482450719174NAC domain-containing protein 19
3swm_B8e-482450719174NAC domain-containing protein 19
3swm_C8e-482450719174NAC domain-containing protein 19
3swm_D8e-482450719174NAC domain-containing protein 19
3swp_A8e-482450719174NAC domain-containing protein 19
3swp_B8e-482450719174NAC domain-containing protein 19
3swp_C8e-482450719174NAC domain-containing protein 19
3swp_D8e-482450719174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0137470.0BT013747.1 Lycopersicon esculentum clone 132610F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361710.10.0PREDICTED: NAC domain-containing protein 53-like
SwissprotQ84K009e-99NAC78_ARATH; NAC domain-containing protein 78
TrEMBLM1D2F90.0M1D2F9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.13e-96NAC domain containing protein 53